Protein Details: Potassium channel subfamily K member 1

Protein ID

ICDB_Pro_1734

Protein Name

Potassium channel subfamily K member 1

Gene Name

Kcnk1

Organism

Rattus norvegicus (Rat)

Length

336 amino acids

AlphaFoldDB

AF-Q9Z2T2-F1-model_v4.pdb

Function

Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes; but also in kidney and in other tissues. Forms dimeric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel is selective for K(+) ions at physiological potassium concentrations and at neutral pH; but becomes permeable to Na(+) at subphysiological K(+) levels and upon acidification of the extracellular medium. The homodimer has very low potassium channel activity; when expressed in heterologous systems; and can function as weakly inward rectifying potassium channel. Channel activity is modulated by activation of serotonin receptors. Heterodimeric channels containing KCNK1 and KCNK2 have much higher activity; and may represent the predominant form in astrocytes (By similarity). Heterodimeric channels containing KCNK1 and KCNK3 or KCNK9 have much higher activity. Heterodimeric channels formed by KCNK1 and KCNK9 may contribute to halothane-sensitive currents (By similarity). Mediates outward rectifying potassium currents in dentate gyrus granule cells and contributes to the regulation of their resting membrane potential (By similarity). Contributes to the regulation of action potential firing in dentate gyrus granule cells and down-regulates their intrinsic excitability (By similarity). Contributes to the regulation of the resting membrane potential of pancreatic beta cells (By similarity). In astrocytes; the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors; such as F2R and CNR1 (By similarity). Required for normal ion and water transport in the kidney (By similarity). The low channel activity of homodimeric KCNK1 may be due to sumoylation. The low channel activity may be due to rapid internalization from the cell membrane and retention in recycling endosomes (By similarity).

Sequence

MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIMEHDQLSFSSITEQAAGLKEEQKQNEPFVASQSPPYEDGSANH

PDB Structures

Ligand Binding

1. DICL_CP

2. DICL_Pep

Binding Site

Disease

Location

Detected in brain and in kidney cortex and medulla; especially at the renal brush border membranes of the proximal convoluted tubules; in distal tubules and on intercalated cells of the collecting duct (PubMed:9843722). Detected cerebellum granule neurons. Detected in astrocytes in hippocampus stratum radiatum (PubMed:19571146). Detected in astrocytes in hippocampus stratum radiatum (PubMed:19571146). Detected in astrocytes in hippocampus stratum radiatum (PubMed:19571146). Highly expressed in the stria vascularis in the cochlea (PubMed:12855359). Detected in neurons in Scarpas ganglion in the inner ear; at nerve terminals in the crista ampullaris; in supporting cells and dark cells; but not in hair cells (PubMed:18838117) (at protein level). Detected in the brain cerebellar granule cell layer; amygdala; thalamus reticular nucleus; habenula; mesencephalic trigeminal neurons; neocortex and piriform cortex; and at lower levels in the olfactory bulb (PubMed:11567039). Detected cerebellum granule neurons (PubMed:23169818; PubMed:25305496). Detected in Scarpas ganglia and crista ampullaris in the inner ear (PubMed:18838117)..

DOI ID

10.1101/gr.2596504; 10.1152/ajpcell.1998.275.6.c1602; 10.1523/jneurosci.21-19-07491.2001; 10.1016/s0378-5955(03)00162-x; 10.1124/mol.107.034389; 10.1016/j.heares.2008.09.004; 10.1523/jneurosci.5784-08.2009; 10.1074/jbc.m112.398164; 10.1038/ncomms1871; 10.1126/scisignal.2003431; 10.1016/j.bbrc.2014.10.012; 10.1113/jphysiol.2014.287268; 10.1007/s00424-014-1631-y

RefSeq

NP_067720.1

Feature